PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010106529.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 329aa    MW: 36108.2 Da    PI: 6.3224
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010106529.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.73.1e-29144197155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +prl+Wtp LH+rFv++v +L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  XP_010106529.1 144 RPRLVWTPHLHKRFVDVVGHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 197
                     59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.66E-19141201IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-29143202IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-23145197IPR006447Myb domain, plants
PfamPF002493.3E-6147196IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGEEVKMSEY EGGVDCGDEE RVLEWEAGLP SVDDLTPLSQ PLIPPELASA FSISPVQYRT  60
LLDVNQASED TLSSLRGITQ SPNIFKSLGE SHESAVVEAD ENDRDGSGSD SRKSRKIMDC  120
AEEDDSALPV DNSGDDPAAR TLKRPRLVWT PHLHKRFVDV VGHLGIKNAV PKTIMQLMNV  180
EGLTRENVAS HLQKYRLYLK RMQGLSTEGP SASDQLFSST PVPQSLHEFS TASGHSNGHS  240
HGNGHFQVPV PIPYPPVMPM PVLGMTHHGH GHMGMPVGAP PKGAVGYHHG FESHHHHHHP  300
FNMLQQQRDW SGNNYGSVVT YPHVARSDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-19143202463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106529.10.0Two-component response regulator
SwissprotQ9SNB47e-90PCL1_ARATH; Transcription factor LUX
TrEMBLW9RUI20.0W9RUI2_9R
STRINGVIT_06s0004g05120.t011e-138(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69573347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.21e-83G2-like family protein